DPCstruct | MC31035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2PLR5 | 13-118 | KIERHSMLENISRESRRSISRGRAIPPPISCIGKSGRPGVYFQSYRQDGRFVLREVRIPTQELLHACREDGRLKLQFIQPNDEVHDE… |
| A0A804I5L6 | 112-188 | VGGGHPNNCSDVRTKTGGFPPPISSIGKSGKPWIYFKSYRHEGRFVLREIRIPTKEFLHASREDGRLKLQLVHPDEE |
| A0A218WLD4 | 161-253 | None |
| A0A7J7DKU6 | 29-112 | None |
| A0A2P5XN05 | 9-91 | None |
| A0A166DJL5 | 1-77 | None |
| A0A1U7W5A4 | 1-105 | None |
| A0A444CB71 | 35-110 | None |
| A0A287QYY6 | 84-164 | None |
| A0A0D3HIC9 | 68-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.