DPCstruct | MC31034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 75.56 |
| Assigned Pfam label(s) | PF02965- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376U070 | 21-150 | NVAKEMERQGFTIPLLIGGATTSKTHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRIQHGRKKPRTP… |
| A0A800L7M4 | 2-104 | VYVASEMERQKFEVPLLIGGATTSRKHTAVKIEEKYSSSVIHVIDASRCVGMVSKLLNPDHKKELVHKTKKEYKTIRETFYQNQQKL… |
| A0A0B1PH14 | 28-142 | None |
| A0A1X7TBL3 | 67-197 | None |
| A0A2K8U605 | 470-586 | None |
| A0A0D2MET8 | 248-376 | None |
| A0A378N3K3 | 50-201 | None |
| G6C3S5 | 190-304 | None |
| A0A7J6TWA5 | 249-360 | None |
| A0A379AMY3 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.