DPCstruct | MC3103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 205 ± 29 aa |
| Standard deviation of domain lengths | 29.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218WE83 | 96-301 | LAGGDGEPEFDEEKEIEGQEDTVLPNDGSDDFDLLELWETGVEFCQGGSFTCSVPFKIYDLPNLEDVLSVNVWSECLTEEERLGLTK… |
| A0A674NMM6 | 10-171 | DPLDPKEEPVGHITEECTLGNCRVNLPEDLLEDPDIFFSVVSESTWSEVLSDSQREHLRQFLPQFPENNAGEQESTISDLFNNGNFN… |
| K8F3X1 | 63-319 | None |
| A0A2G8LL68 | 4-166 | None |
| A0A5B6WDH0 | 1-248 | None |
| A0A834TDZ1 | 3-272 | None |
| A0A5B8MQU7 | 26-211 | None |
| A0A6A2YQP4 | 35-218 | None |
| A0A6A4NHE5 | 3-201 | None |
| A0A2I0T751 | 12-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.