DPCstruct | MC31025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6Y5Q7 | 12-162 | LALLLSFGVAMQANAAALTWTADQTIDFSSPDVNITIQSGSKATSLVVGTGTLQVVVANTDVFSITSATTDFSFSGNTTSLVSSTCP… |
| A0A554MFI1 | 1-140 | MRKVSFIGYTTVVVATVAMAPFAALAATTDADVTLTLPSDGSAYTLKSGGTFDQFSSSGDTFTFQADAGGVVSVDIRSGDKKNLTNN… |
| A0A1F8H6F1 | 1-163 | None |
| A0A0G1UC45 | 1-162 | None |
| A0A1G2L5Z8 | 1-128 | None |
| A0A1F6LJD2 | 1-147 | None |
| A0A1F7BEA0 | 7-176 | None |
| A0A1G2VA30 | 10-144 | None |
| A0A0G1P2W2 | 15-173 | None |
| A0A1G1Z6L9 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.