DPCstruct | MC31023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 58.53 |
| Pfam Score | 98.18 |
| Assigned Pfam label(s) | CL0430- CL0167- PF08427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5DGW0 | 2-97 | VNVPKTRRTYCKKCKKHQTHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRQKRMVPIKRC… |
| A0A095BUU7 | 1-94 | MVNIPKTRNTFCKSAKCKKHTLHKVTQYKKGKDSLYAQGKRRYDRKQSVSRSGLTVSSQYGALLQCKDMTNWVPIFVRKNHPNSVLL… |
| U6LK45 | 1-100 | None |
| A0A0M3ISX4 | 1-104 | None |
| A0A670J290 | 30-131 | None |
| A0A669EI05 | 12-116 | None |
| A0A2U1QCZ9 | 22-101 | None |
| A0A421JR72 | 284-390 | None |
| A0A2G3CET5 | 21-124 | None |
| H0Y3V9 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.