DPCstruct | MC31018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 225 ± 41 aa |
| Standard deviation of domain lengths | 41.35 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094ZIN1 | 2-225 | DDFLGCVTIDIKDIPSTGLDSWFKLEGRSNRSKVQGEIHLALNLSAQNDLNEVERDKTVAIQEHIQLFYLFSLYQLKQENSTGIPWN… |
| E2AEY2 | 1-166 | MWYALEKKNKSKRRGVIKLRLAFSAEHNVQVAAQEHRHLLRVLLLHEIEAEKIEKYCWCGRWSGPAEALILQHSAQRGLLARNLALA… |
| A0A3Q0KV50 | 319-545 | None |
| A0A5B7CH79 | 175-353 | None |
| A0A5B7CNM1 | 61-285 | None |
| A0A183LCC7 | 81-308 | None |
| A0A813TVY0 | 349-574 | None |
| A0A821VJ78 | 390-632 | None |
| A0A6G0TVF0 | 156-381 | None |
| S7Q6G5 | 417-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.