DPCstruct | MC31015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2IRQ7 | 234-334 | DDGLPIVVSWPVLTSTVQPEDFLFTLNTGEQVVPHSAGLVPNWELNERNVIVVFGDFGNRGRADEPDAVFPVKLEIVDDGTPLVFLG… |
| A0A848UG17 | 39-161 | TAAGVEMFYRGVADDEPDYDDGLPVVFTWPVLTSTVHPQDFLFTLNTGEQVVPNAAGMMPNYELNERNTVVLFGDFGNRLDGGEAVY… |
| A0A853HS60 | 63-196 | None |
| A0A2D8RMY2 | 201-310 | None |
| A0A7S3XAX5 | 127-260 | None |
| A0A1V8M5V4 | 349-479 | None |
| A0A7G8IFF4 | 79-224 | None |
| A0A850BH19 | 329-438 | None |
| A0A2E0WD11 | 203-338 | None |
| A0A2R4XG26 | 88-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.