DPCstruct | MC31012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 525 ± 80 aa |
| Standard deviation of domain lengths | 79.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5M1U3 | 37-557 | VFTQDFKYNGKDNIVSMWRNGKQEFYEIHPDLYEAFNGIDPLKLGPIGKVFAPFARMLRLGATELKFSFGFARNPFRDALSYAVFSK… |
| A0A1V5VS24 | 19-630 | RAAKEVLDTAARMGAATDMTNDVVAQDINGQPIYRGNTKGLVRYRGEIKRKIPKGQPYIENGQTLISDGTAEISYVGERYFKVDDPH… |
| A0A7C4TZ16 | 123-699 | None |
| A0A7X9BAK0 | 34-462 | None |
| A0A350PLL0 | 187-839 | None |
| A0A6F9NUI7 | 31-542 | None |
| A0A1V6F745 | 456-974 | None |
| A0A1G9U0C8 | 58-556 | None |
| A0A0F9SV38 | 521-1057 | None |
| A0A1Z1NQI8 | 159-753 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.