DPCstruct | MC31011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4QBS1 | 1-124 | MCKSTFYPDKAYLEKLTLKCPHCSKALCKKRDRKQFFVYTCVNRCCPFYVRNLTSISKDEKTDFDKNPYKYKLHYYYRVFDIKLESL… |
| B9E1S2 | 138-255 | LCPYCGHTLSPKKDRKHFRIHKCVNPECSYYQSNLTKLPKNLDVSDKHKYKLHYIYREFTVDFFKMDLHALPKSTINFKYKKFNAYI… |
| A0A1M6MSE7 | 568-677 | None |
| R5KU21 | 137-239 | None |
| A0A1I3AXJ5 | 49-177 | None |
| A0A6I8MCP8 | 155-264 | None |
| A0A1Y4MGS4 | 53-174 | None |
| A0A3P6JN85 | 64-173 | None |
| A0A139D1T4 | 124-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.