DPCstruct | MC31010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5Y0J7 | 38-204 | QKVKVVIGFITSDTQLIKEVNQELFPLLGEPDFLSEIIDFNFTDYYEQEMGKNLKRQWVAYKNLIMPDFLASLKIKTNEIEEQFKVA… |
| L0RVU4 | 3-139 | PCIYASAVLPFNHTDYYTDEMGDGLKRQIFAFAKLIDPGELSDLKQWSNLLEQDWSIDGKRRVNIDIGYISLAKLVLASTKDHSHRL… |
| A0A7C4HNE3 | 272-444 | None |
| A0A101EGD3 | 10-165 | None |
| A0A660S9R8 | 5-164 | None |
| A0A419IHE7 | 82-233 | None |
| A0A7C0UKM0 | 1-118 | None |
| A0A2N1PRL3 | 16-187 | None |
| A0A0S8K7P9 | 2-164 | None |
| A0A2H0YG65 | 32-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.