DPCstruct | MC3101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.66 |
| Pfam Score | 86.81 |
| Assigned Pfam label(s) | CL0061- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438DPT5 | 1-97 | MAKIQISLCVVCLVCSLILNLLLVSNHMHVGGKWELSWSRKAAEEGEAAAAVACSGHGRAYLDGLVVDGSPVCECNSCFEGPDCSQF… |
| A0A218W0H3 | 3-105 | ETKKDTSIKFVQCVASCSIALNLFLALNLYLGSSGKVINNQLSWSRLAAEEAELAASMDCSGHGRAYLDGFPIDGKPVCECNLCYGG… |
| A0A3S3M5Q7 | 14-121 | None |
| A0A5A7RET3 | 4-100 | None |
| A0A7J7DSH2 | 44-143 | None |
| B6U817 | 9-133 | None |
| A0A438DPN1 | 1-95 | None |
| A0A0D9V4Z5 | 21-117 | None |
| A0A1R3JUZ8 | 6-98 | None |
| F6H6R3 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.