DPCstruct | MC31004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 227 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 36.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534UYK4 | 152-368 | LTTVTQVCPRCNNGKCDTGPNQGKNCTVDGTLVVTQSLGANKAYNLSRDCPPDPGALAAPLDIRLPMTTGTAMLAGPTPCTAQPGQP… |
| A0A534TFU7 | 30-239 | KACPTCSGATLESTGTCSGGARDGMPCTVHGTTLRFGNMSFDCPASPSANIGNLPVPYDLTTGTRSIEAGPTCTGAGAGTCWCQGQA… |
| A0A534UJT2 | 272-492 | None |
| A0A534WPV5 | 43-298 | None |
| A0A534WHM6 | 131-366 | None |
| A0A534WFU1 | 577-816 | None |
| A0A534WBH3 | 38-308 | None |
| A0A534V417 | 92-271 | None |
| A0A2V7T330 | 278-493 | None |
| A0A534SAT4 | 89-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.