DPCstruct | MC31003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.82 |
| Pfam Score | 88.90 |
| Assigned Pfam label(s) | PF01502- CL0231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534TDU5 | 6-104 | LLDGPPSPGETLAALERVLRSRRREAPEGSYSAKLFADEALRHKKVGEEAAELVVASLRGKPDEIAHEAADLFYHALVLLQAHGITL… |
| A0A1Q3LLD3 | 1-80 | MFAELTTTAETRPEGSGTVAQLDRGVHAIGKKIVEEAAEVWMAAEYQSDDETAEEISQLLYHLQVLMLAKGLTLQDVYRH |
| A0A7T5JU54 | 211-337 | None |
| A0LCF5 | 5-107 | None |
| A0A4Q3JFU9 | 1-102 | None |
| A0A0L8VW28 | 8-104 | None |
| A0A817FZP3 | 62-184 | None |
| A0A5J4Z043 | 289-396 | None |
| A0A7Y7D8J4 | 1-80 | None |
| A0A7C4Y137 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.