DPCstruct | MC3100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251UPP5 | 1-95 | MVPGSQDNSGDALLIDIDSNATPTYTYVPKQLSKEELTKLLPEKWITNYEQIHQAPVQTTTTPDFVRHQDGQVEVRFPKQDRREIFC… |
| A0A218VZ77 | 1-108 | MAYRVHNHALNLSLSGSEDALIISVDSMNALTCVHVPRQISRVDLVKLLLETWVTNYERLHQNAQLIQSSELKFRKRPDGKVVISFD… |
| A0A1S4AH92 | 1-110 | None |
| A0A068VIL5 | 1-105 | None |
| A0A2I0KMB6 | 1-108 | None |
| A0A218Y2H4 | 1-88 | None |
| A0A2K2CA71 | 35-136 | None |
| A0A565AYB6 | 37-113 | None |
| A0A1R3HRZ7 | 5-98 | None |
| A0A1U7V0H3 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.