DPCstruct | MC310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7BE06 | 95-206 | NSKIDSPDLCLQEPMKSAEAPKSIIKVSKDDYEDLPSYMKSLASWEDLLAAVEKMNSSLNEKEQTKGGNFFHQDELALLGLGLKGRS… |
| C6TMY0 | 4-139 | SKGDLSPQEPEKVQEFKQQHQHDADTEGSNFLSDEQDKENIKSAEAPRPILKILKSEFECLPAYMKGLTSWEDLLVAVGKINSSLSK… |
| D8LMT0 | 478-628 | None |
| A0A4D6MBG6 | 987-1108 | None |
| A0A5P1F7A3 | 497-605 | None |
| A0A4U5U0Y2 | 177-324 | None |
| L8GRF7 | 135-304 | None |
| A0A6P3WG96 | 518-695 | None |
| A0A2D0R6U5 | 375-548 | None |
| A0A453JJT2 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.