DPCstruct | MC31
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4AAS8 | 1-86 | MDWGDYTTAIRRWELILGRPAPPPTELGRTGRPRLSPRFVEWMMGLPDGFVTDPALGLPRNAQLRALGNGVVPQQAAHAITLLIDE |
| A0A6G4WPY0 | 4-91 | PAPTRETSNDATDWGPYAAAVERWEELTRPAPRPVDGRGRLNPALVEWLMGLPDGHVTAVPQLSRVAQLKALGNGVVHQQAAAALRLL |
| D9UI39 | 162-252 | None |
| A0A1S2P111 | 43-126 | None |
| A0A4R5P818 | 333-432 | None |
| A0A1H9M9C5 | 140-254 | None |
| A0A1Q5Q0G8 | 200-290 | None |
| A0A7W8FCH1 | 88-189 | None |
| A0A419I6T0 | 67-144 | None |
| A0A1H4CGW7 | 5-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.