DPCstruct | MC30991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4DQF5 | 14-171 | VWMRVRPDAVTVWDDEDVKRRLDWYYRVMNDKAPAKFLIAKIVDAGENPAKLDLDGLWDLHHRLSSEHRRLWKEAIRGELELKEVLN… |
| A0A1Q9N7A9 | 1-147 | MFDHYNSVVKHVKPAKYLACKKIMQPDKTIGDLQDTLLLHEKLAAEFPRVYNKLLEKSDNSVSKDFNGVNYLEIKKIIVEKMLEKCI… |
| A0A497EY27 | 1-155 | None |
| A0A2A5NZQ3 | 10-162 | None |
| A0A3M1TJ18 | 1-160 | None |
| A0A7J3FAV5 | 23-146 | None |
| A0A7X5W138 | 44-158 | None |
| A0A7V4LD07 | 25-163 | None |
| A0A2M7G2L1 | 4-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.