DPCstruct | MC30988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 193 ± 21 aa |
| Standard deviation of domain lengths | 20.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2SBL3 | 58-252 | SETAYNTGHNAAIQYALRTDSDLAVAYAMNAFADHFLHDHFSSGHLRVPRRQLHGSTLNVADACSKLMHDEDSCIGLKVSNQNGDSW… |
| A0A120G9B5 | 2-187 | AHQTGTDQALELAYAMNSFADHFLTDLFSAGHLRVPRKQLAAVVTPGELGSLISRFMHDEDSKFGLKVRNAMGAQWHAYGDKRYFDS… |
| A0A1J8QEX2 | 209-382 | None |
| A0A3M6UYG6 | 12-163 | None |
| A0A2N6P138 | 199-408 | None |
| A0A850B4V9 | 303-492 | None |
| A0A7G3ZXU5 | 226-450 | None |
| A0A1M3CSB6 | 241-408 | None |
| A0A0W0VKW9 | 24-210 | None |
| A0A6S7LP58 | 156-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.