DPCstruct | MC3098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 172 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1ZPH8 | 755-904 | LSFFGTFFTHLEAWVTSSTAELLASGPDAELALPPPTSPEVLAALSRCLSAALPPVCAGLQAAAARGQVERSLDELLRTLRLVGPLP… |
| A0A218VSJ3 | 1-169 | MWGAPFSWVTSSSLAYIYGQDESFHEEYLSVNGREYPQKVVLADGRSSEIKQTLAGCLARALPGLVADLRLPIPISTLEQALGRLLD… |
| A0A6J1GVD1 | 461-620 | None |
| I0ZAZ4 | 417-574 | None |
| A0A0A9UQT0 | 1-187 | None |
| A0A015KBW8 | 83-257 | None |
| A0A397IVS5 | 128-304 | None |
| C1MYA4 | 288-499 | None |
| A0A6P3ZBA8 | 558-716 | None |
| A0A5B8MQZ1 | 470-649 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.