DPCstruct | MC30973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9HUG0 | 3-133 | MIDIQELLIYPDELGTGYDQWGVLHGTWSVDSGEEVVLYLRGLRQRRWGPDQAVWLHRSVTVTAIHTSGLMFTLTASSARHGLSHVV… |
| A0A067RCF9 | 21-146 | NTLKEFHQSHYEQYGSLKGHVEINGNKYPVHLDGFRDHSYGHKREWCNFHRYALHFITLENGARINASVVCVPLVFSRLELGYMYKP… |
| S4R4A7 | 2-126 | None |
| A0A7I0ZM43 | 231-366 | None |
| E2AW36 | 101-224 | None |
| A0A6J2JHN1 | 238-350 | None |
| A0A5N4A2N8 | 216-337 | None |
| K1RHG8 | 173-307 | None |
| A0A3R7PZJ8 | 111-225 | None |
| A0A212FG75 | 222-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.