DPCstruct | MC3097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7CRY6 | 3-108 | RAPASAMESKMVNDAVAYIRSLAEMRGRNADWAERAVRDAESLSATAALRENVIDIVAGDEAELFRQAHGRVVQVEGRELSLDTRDL… |
| L8PNB6 | 1-124 | MAPGTHIRAATPVTGEGEEVSDKVVNDSAAFAVSIAERRDRNTELAESLVREGTSVADRQALWDNVVDLVTPSRGALLGDVDGRMVV… |
| A0A0F9FTL3 | 1-100 | None |
| A0A536DBL7 | 44-169 | None |
| A0A0B8QHM4 | 9-120 | None |
| A0A1W9PED2 | 116-236 | None |
| A0A848QMG9 | 2-108 | None |
| A0A2E7LMN9 | 2-105 | None |
| A0A455UBB0 | 10-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.