DPCstruct | MC30968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9BTT6 | 51-152 | CIFIKLNKIYGWVPPVFETVDELPEDMPGYLRDEIKSQYSDGQNKITKKMVWLSCQGENAADKENIGELSITPYPGIPAAYFPFMRQ… |
| A0A0L7LDP8 | 134-231 | CVFLKLNKIFNWIPRPYNNTEGLPEKMPEDLKQHIKMVSGKPEANTVWVSCEGENPADVENVGPVQYIPRRGFPAYYYPFTNKEGYL… |
| A0A182T2D2 | 123-216 | None |
| A0A7R8X409 | 189-289 | None |
| A0A7R9NW71 | 159-249 | None |
| A0A4C1UZZ6 | 356-481 | None |
| A0A553PPS8 | 237-360 | None |
| A0A7R9I3K7 | 114-206 | None |
| A0A182M352 | 186-285 | None |
| A0A4C1YPU3 | 120-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.