DPCstruct | MC30966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848ZJ28 | 24-102 | WAKGGNADRQKKQIRRISGGVKSGEITRKESKRLGREQRRIGQIKRNARADGRVNARERRRIHKLQDRASRHIYLAKHN |
| A0A3N7ARV1 | 1-94 | MLAAVSAQSFAATEFQKEHPRRAEVNHRLENQDKRIHQEVKEGKMSKAEAKKLHKDDHQIRKEEKAMASQNGGHITKLEQKTLNQQE… |
| A0A317CHH7 | 15-111 | None |
| A0A7W7YCH4 | 11-126 | None |
| A0A7Y3CGK6 | 4-90 | None |
| A0A0B6X0J4 | 14-111 | None |
| A0A849Y5R0 | 53-137 | None |
| A0A1F3ZWQ9 | 142-223 | None |
| A0A084Y2X0 | 106-208 | None |
| A0A0S8C3V6 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.