DPCstruct | MC30963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 253 ± 57 aa |
| Standard deviation of domain lengths | 57.09 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6ZXB6 | 2-213 | LKNYISHTFLKLKDEYDKEVDPEEKKRIIYEDDKLACFNTGLFTSTYEPIYALFYINSVPGKQKWKFSDFKTEYQLTLIGVPVLPHR… |
| A0A7X7Y1E5 | 19-242 | SDSEVPILQNYIFFTYDRLKAEKKIAISPDDGSMCFNTGLQTKDYEEDIYAYFLANERFPNESNQKWFFVKFCKQYDSELRIFTTLP… |
| A0A095XJ88 | 168-493 | None |
| A0A4U8SVZ6 | 414-661 | None |
| A0A1Z4V650 | 9-227 | None |
| A0A3D4DLE3 | 72-393 | None |
| A0A838R9K2 | 43-290 | None |
| A0A229VX60 | 41-314 | None |
| U1WSV4 | 438-673 | None |
| A0A843MFT0 | 347-691 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.