DPCstruct | MC3096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9EQ38 | 9-93 | GIKVRQPVVLDHSREYSTPDWKSDGMHAFCPRDVLLAVGRTIIETPMSLRSRQYESLAYRPILREYMDSGARWISAPRPELKESG |
| L8PLA5 | 21-110 | ISVRRPDPIDHRKRFATPDWPSRGFCNTCPRDRLLVIGDEIIETPTAWPCRYFETHSYRTILKDYVRRGARWTGAPRPQLTDELFDP… |
| A0A177B536 | 100-183 | None |
| A0A6J7ZLV4 | 2-78 | None |
| A0A068QT72 | 28-132 | None |
| A0A815EFU9 | 123-212 | None |
| A0A6I1ZUX8 | 4-117 | None |
| H9G945 | 34-144 | None |
| A0A7Y7BAP3 | 4-85 | None |
| A0A7L5AWT6 | 392-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.