DPCstruct | MC30959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 254 ± 35 aa |
| Standard deviation of domain lengths | 34.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285VAM2 | 15-227 | DTSGDPDGHSLTLRRYHQLLWSKALPGGAPFDLEVAGRKGRYFLRHTSALGDFKLSSDAITTRLHRQIPRIVAQTRPEELPADPGYT… |
| A0A1I3BJ29 | 3-201 | LWSKPLPNGVLFDLDDHTPDAYLHHKSALGEFYLASDSVIPTFDSWFRMAHIIDEIPEVERKSFHDIGYTIGGMMLFPGNKVDGKQT… |
| A0A3D1GYS5 | 459-728 | None |
| A0A841E674 | 111-318 | None |
| A0A8A8TFV8 | 7-303 | None |
| A0A415S240 | 76-312 | None |
| A0A7C7ADJ0 | 18-337 | None |
| A0A417AWM3 | 66-303 | None |
| A0A7C6WZZ0 | 29-324 | None |
| G9XB64 | 22-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.