DPCstruct | MC30956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 171 ± 30 aa |
| Standard deviation of domain lengths | 29.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09725 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1I690 | 10-157 | LNPYELHKHLINTYVLNRKGSTNFLKRDTSKDKTDIDVIRENHKFIWEDDEQPTTWEERLARKYYDKLYKEFCIADLSRYKENMFAM… |
| A0A0L0SCR1 | 1-173 | MDAYRRHQQYMRDYAQYFGGPSPPPTAPPSATQTEHDLVRQHHQFLRDPNADALIATLDGNGRWAAQLAKAYYDRLFKEYCLGDLSR… |
| A0A835NS53 | 111-275 | None |
| A0A0F7SPQ4 | 31-231 | None |
| D3B0P8 | 11-159 | None |
| A0A1C7NIV2 | 12-191 | None |
| A4RX44 | 21-192 | None |
| A0A218X047 | 63-199 | None |
| A0A2T7P9U4 | 19-218 | None |
| A0A369S9F5 | 96-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.