DPCstruct | MC30955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 183 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 38.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0SCL6 | 2-201 | RENADGEMQVRGHVKLLEDGRVYAMNQRSVLVKSTDDAAEVLAVGLAHRAAGASSLNDQSSRSHGVLELEIVNDDLIRARDEVAEAE… |
| A0A178ZLA6 | 3-201 | KKSAFDLLNWRAECHIREGADGKVYIRGETEKLQDGKVRVCPIVKQPCWTYDSFRQELTRAFGRRTVGSSTLHDQSSRTHAILELEV… |
| A0A0E1RWP3 | 1-164 | None |
| A0A2P4X2S0 | 2-196 | None |
| A0A485KMW2 | 52-226 | None |
| A0A7S3BLT9 | 84-275 | None |
| A0A3R7GYQ9 | 675-842 | None |
| A0A0J8QHL8 | 2-176 | None |
| A0A6C1LN07 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.