DPCstruct | MC30952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 188 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R6YD18 | 169-358 | ALLLHPQFALAVAAYLVLTLAYSFRLKRYALLDVTVIGALFTLRIVMGQVLNDLAFSPWLLSFSAMFFFSLSLAKRHVEAMRACSKG… |
| A0A7W0Q0S7 | 1-171 | FLALQGAYTASLKHVVLVDVLVIASLFVVRAAVGAVGIDVRLSPWLVLCSGLLALFLALGKRRGELVLVGAELTPGRQVLEGYSLAL… |
| A0A5N9EF23 | 3-195 | None |
| A0A537Y8V0 | 1-193 | None |
| A0A1V3X8K3 | 117-295 | None |
| A0A173J7F8 | 220-411 | None |
| A0A5S4YL59 | 464-635 | None |
| A0A0G1TG31 | 395-606 | None |
| A0A0Q5ZG40 | 300-487 | None |
| A0A1F5NLA5 | 2-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.