DPCstruct | MC30951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9YSB4 | 304-428 | LTTSDIETRDGDTYLALGPEPLLLIPPLDALVTALPVAKPFGTASTLADGRWLFTGKNAGTHLHPTSLMARMNRLGITTRASRNTAL… |
| A0A7I9WCY6 | 1-110 | MLPEPLSRLVCDLVTTRRGHAVLGDQGTSAWLFPGGQPHRPVSADRLGQRLRLIGLRPAQTRSTALFQLATELPAAVLARMLGIHIN… |
| A0A239CZU0 | 30-140 | None |
| A0A4V2S580 | 3-117 | None |
| A0A5Q4SSS3 | 2-82 | None |
| A0A3Q9KGT0 | 82-169 | None |
| A0A1Y0BWR2 | 1-98 | None |
| A0A7R7GUT3 | 7-99 | None |
| A0A365P806 | 113-241 | None |
| A0A5Q0H3I8 | 55-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.