DPCstruct | MC30950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5RR74 | 1-82 | MLGAPCSDTAYYVFGTTSWGRLVFCGSPRRYEPRYFRSPPLKGIREENSPCQGFENSVAQAPDGLFLSCVPSDGSVRWLRGD |
| A0A7I9VVK8 | 15-126 | ALCAAPTAGAAPGDTPVPNMKDGVALGTPCTNTTRFVFGWDANGNVLACRSPLPGEQSQWVPGGKLVGVRAIRSECILDVYGQSPDF… |
| A0A081I8H4 | 119-224 | None |
| A0A1C7EYK8 | 172-273 | None |
| A0A7K2HPH1 | 1-109 | None |
| A0A1H8ARE0 | 61-171 | None |
| A0A6I3L4A0 | 79-219 | None |
| X7V6R1 | 11-105 | None |
| A0A6N4W537 | 1-92 | None |
| H5TV62 | 21-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.