DPCstruct | MC3095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 242 |
|---|---|
| Mean domain length (aa) | 196 ± 35 aa |
| Standard deviation of domain lengths | 35.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 99.46 |
| Assigned Pfam label(s) | CL0184- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5TMY5 | 3-213 | QYTIGIDFGTLSGRAVVMDTRNGTKLAAAAADYPHAVLDDELPQQIKLGDDWALQHPGDYIHVLKTAVPEAVQQSGVPKEDVIGIAI… |
| A0A2X1NBI9 | 1-145 | MDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRR… |
| A0A0K2RTU3 | 264-419 | None |
| A0A0M8N968 | 690-904 | None |
| A0A496SC40 | 1-116 | None |
| A0A6G6WS86 | 8-206 | None |
| A0A7C5UVB9 | 3-204 | None |
| A0A182F8J9 | 661-867 | None |
| A0A1X6PIR0 | 77-288 | None |
| R9NXD5 | 117-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.