DPCstruct | MC30947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 128 ± 24 aa |
| Standard deviation of domain lengths | 24.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3CTR1 | 2-78 | ADDLYELEYLSLVNMIAQEIGDRVGNMDKVVAKFIIMLHDQSNNSLSDFKAKLEKSSASFPDSLIESVDGLILNMHP |
| A0A6P7GVK9 | 4-136 | LQKLEYLSLVSKVCTELENHLGMNDKDLAEFIIHLSEKNGTFESFKKALIENGAEFSDSFISNLLRIIQHMKPKKNKSKVEADVYQK… |
| A0A444XHS2 | 8-110 | None |
| A0A6D2L2C2 | 118-253 | None |
| A0A6D2LFF1 | 4-146 | None |
| A0A4Q9P298 | 5-153 | None |
| A0A6D2I7V7 | 1-124 | None |
| A0A183Q483 | 8-135 | None |
| A0A4Q9MRS8 | 5-152 | None |
| A0A0G4M7E0 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.