DPCstruct | MC30942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 53 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 68.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7GLN9 | 1-58 | MPNFALSSEIPFSKRNLKYLTKKYLKKNNLRDWLRVVASGKDSYELGYFQIDIQDDEN |
| A0A061JAB0 | 22-82 | RVRLHNKVLTILTTMAYRKKYFKYLTKKFLKKKDLRDWIRILARGKDTYQLKYFNIQDQEE |
| A0A7R9T4C0 | 230-280 | None |
| G3I949 | 115-161 | None |
| A0A0M3HJ58 | 6-62 | None |
| A0A0R3Q8E1 | 2-48 | None |
| A0A6A2XML7 | 131-183 | None |
| A0A4T9W980 | 1-46 | None |
| K4AEP2 | 178-229 | None |
| Q28D44 | 429-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.