DPCstruct | MC30941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 14.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SDC0 | 13-146 | EPYSLNERIELSFKLVHSNSLVLLWSFTDPIHPQLFLEAPEDILCFKFNPSNPNLIVGGCINGQVVIWDITDYQERLQIHRSINTKE… |
| A0A1B6CBV5 | 689-796 | PVLIWSFVDDLTPKLRLDSPYEVTCVEFCPHNGNILAGGTVSGQVVVWDITGRIEELEQPETLTPQQQKHKKVMEYLMDWRRDTRSR… |
| A0A812ZHF9 | 782-917 | None |
| A0A2K1KZJ4 | 338-474 | None |
| A0A3Q3VLL7 | 258-366 | None |
| A0A1W0A0Y5 | 345-454 | None |
| A0A1S3JCZ1 | 432-552 | None |
| A0A812DV80 | 653-792 | None |
| E9ILX4 | 441-588 | None |
| A0A0L8GAR4 | 320-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.