DPCstruct | MC30939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835G9W2 | 1-83 | MRDEALTCNVCDRSFPTRRQLADHQQKKRHFGCSACDSLFPSLMALEHHKEEFQHWSDSSYCSHSDSDDSDLETCHEDRHRLL |
| A0A6P7GBV0 | 1-68 | MFACPKQLSSHKQKKRHFGCSACDSIFPSLMSLEHHKDEFEHWSDEDDYLTDTEEDDESVSEECERLI |
| T1JK55 | 25-113 | None |
| A0A7E4RU20 | 59-135 | None |
| A0A164TM11 | 116-192 | None |
| A0A3S3Q7A1 | 230-310 | None |
| A0A6J1X2I1 | 82-162 | None |
| A0A182ISX7 | 9-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.