DPCstruct | MC30938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 252 ± 29 aa |
| Standard deviation of domain lengths | 29.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835CS60 | 1-207 | MFTSVFSVPINLPFWYQPCGSKIEPDNYNLNNIEHEIKSSLNRMKLQHGIALGSFKKGNYENNYDKAGNHIARKQYIPHWIPNEHDI… |
| A0A6P7G6Z5 | 39-305 | TSDASTKISSIFSSIVFNKKRTKFSYLIWKKGYLIHTYNFPRVKNVVLVLVYLTLTMMNSASTAPAPKDDKWWESPCGSSPEPAEPL… |
| A0A833RQQ1 | 1-225 | None |
| A0A5N5TCC4 | 203-446 | None |
| B7PIU5 | 38-265 | None |
| T1KLS3 | 21-281 | None |
| A0A6A4K5N8 | 123-390 | None |
| A0A6I9PXH3 | 6-285 | None |
| A0A834K797 | 24-293 | None |
| E2AB84 | 31-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.