DPCstruct | MC30936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6Z321 | 82-184 | ILRVLIYCCVAVAAITVSDDSCKCWREYEAQMVDGKMRCVGLRVRHIMPCNVPQPPKCVCQNATAIVTNANGTFCAKNVNNTRVLEP… |
| A0A6P7G1N9 | 8-128 | ITCFISMIYASRIITRDDPVPDESACICHHGYTIQKHPKDNKFYCKGILHDGKTACVNLERPQCKCTLIKGFVIQDIYRYWCVKVKP… |
| A0A6P7F993 | 5-115 | None |
| A0A6P7F3T4 | 2-119 | None |
| A0A482V972 | 1-106 | None |
| A0A139WFP7 | 32-131 | None |
| A0A1Y1LJ75 | 4-125 | None |
| A0A653DBR3 | 5-108 | None |
| A0A653CJR3 | 6-108 | None |
| A0A834I022 | 30-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.