DPCstruct | MC30935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 30.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4BGI1 | 3-136 | LDMSRDDCKRVLRRLELEGYSAVLSAFRAQGDLTKEKKKILQDLQNILSISTERHRAEVRRAVNDEKFATIAHNISGANTTSEWLIE… |
| A0A6P7G0A3 | 6-160 | LDMTKEESVQNLRNLELEAYSQLVSALRAQGYPNPDKLKLLKDTGYLLNISLDRHKAEVRRAISDEKLNTIAYHITGHTASREDWAK… |
| A0A3P7L9D5 | 14-174 | None |
| A0A1I8HGY0 | 2-134 | None |
| A0A7R8XEU1 | 6-163 | None |
| A0A6I9HN73 | 1-169 | None |
| A0A4Z2D781 | 14-230 | None |
| A0A7R8ZGU5 | 40-215 | None |
| A0A3S3P5X3 | 1-176 | None |
| A0A820GNG5 | 7-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.