DPCstruct | MC30934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 68.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O62771 | 1-52 | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREK |
| A0A3P9CGT6 | 1-63 | MAVPFSNTHLRVPRGFGTILEGLTREVLRDQPEDIPKYAAQYFEALLKERQGNYNFLTFNVMK |
| A0A6I9Y367 | 1-56 | None |
| A0A6P8PXF3 | 1-52 | None |
| A0A1S3SXM8 | 1-53 | None |
| A0A3Q2CI89 | 4-63 | None |
| G3P356 | 1-53 | None |
| C1C3T4 | 1-52 | None |
| A0A4W6D048 | 1-53 | None |
| A0A822D295 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.