DPCstruct | MC30933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 45.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5UWJ4 | 1-78 | MFSDGTIPLVEKGVITGNNKTVHPGKFVTGFVIGSKKLYDFVADNQGIIFLDIAYVHDTDVLRRNPKTTAINSAIGVD |
| A0A645DW42 | 1-87 | MFTESMVDLLECGAADNSRKPIHRGRSVATFALGTRRMYDFIHQNPGFEMLPVDYVNDPSIIALHPDFVSINAALEVDFYGQVCAES |
| A0A044VJ23 | 652-739 | None |
| A0A820DJS3 | 1-78 | None |
| A0A068XXP4 | 120-206 | None |
| D2VMT8 | 291-367 | None |
| A0A7R9LYS2 | 28-115 | None |
| A0A0N1PF29 | 219-305 | None |
| A0A821HNJ1 | 26-112 | None |
| V5GVW0 | 277-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.