DPCstruct | MC30932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 24.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 51.44 |
| Assigned Pfam label(s) | PF14956- PF11161- PF06938- PF21028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5UVT1 | 9-144 | HINCRGDVLHDSCIIDDPIFLNHFYKNMQLNSTNRYMDYRYLSIYGNEYLFIKPEDTPIVFKYLAHHQLFYTQDLSIEFYPKDLRFN… |
| A0A537D8V2 | 14-131 | NVPAVYGWLALDRRGNWRIKGQRISNAALREFIARNYECDAQGRWFFQNGPQRVYVSLAYTPLVVHYDADRLFDQCGRPFGCDTIYQ… |
| M1FFK5 | 185-343 | None |
| A0A803JFR3 | 186-348 | None |
| A0A7S2RG64 | 52-188 | None |
| A0A1W9I4T6 | 22-187 | None |
| A0A7R9KMB9 | 30-166 | None |
| A0A6P3U698 | 15-176 | None |
| A0A0N4ZKP4 | 11-133 | None |
| A0A556TZG4 | 52-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.