DPCstruct | MC30930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 212 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5KV72 | 581-777 | LEVEVNPTNFYFSVDERELKPSDLFSKFDIVDEEGTHFDALELGAVTLDKTTPKEIFDAEGKPYCVKEVNAYFTDPTKADAEPVAAP… |
| R7H581 | 2-188 | KEPGFYFSEDNRAFRVEDLIESVVSIDENGKQTTIDLSQITFKGATPKSTYVQTEKYFAGTIKAYYGDIVAAEPIVYIGVKGDADLS… |
| R7A7R3 | 500-737 | None |
| A0A315Y0B8 | 467-713 | None |
| A0A1K2C0B2 | 11-223 | None |
| A0A1K2BV40 | 566-828 | None |
| A0A1K2BT22 | 21-234 | None |
| A0A374VVD0 | 706-906 | None |
| R5V4L8 | 256-466 | None |
| A0A1V5GKA7 | 587-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.