DPCstruct | MC3093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420YMS0 | 2-99 | TSITPYRLRTLYRHLLRELPPRSILASPRTPLHNRVREQFSSSQTPSESAVAHAEQAAAYFRHQAQYVTLIERYNPGMGMDEEERVR… |
| A0A366Q3I3 | 22-135 | EEETATKITAMASNPATLRSLYRSLLRELPPRPILARNRSPIHARIRSSFAEPAAAHPAAATEAAQFLDYLRAQRVYATLLERYNPG… |
| A0A0D7AIA8 | 8-108 | None |
| A0A0E9NGG4 | 19-128 | None |
| A0A4S9F9Y6 | 51-183 | None |
| A0A0F4GDR7 | 1-115 | None |
| A0A4Y9ZF51 | 1-101 | None |
| A0A093XSN5 | 50-153 | None |
| Q2GRX0 | 2-112 | None |
| A0A6A6P9M2 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.