DPCstruct | MC3092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0TKG4 | 2-138 | WLDNAAIEIAANKFPAYFISPEDGAPTTDTKRVFVVVALRDGFIQEHENGWRRLTKSEVFLLHLYDNINNTEPDAKWPCKIVDHPEL… |
| A0A366Q315 | 4-148 | SVVQDVIWLTQAAEEISRTPGPVYFVPFNLSVEPADEVKFYIIVPLTQEFRDAYASAWRRLARNLTLQVFLFRHTDDKDPATWDCEI… |
| A0A2K0UU45 | 179-330 | None |
| W7MVI4 | 85-245 | None |
| A0A0F9XQP6 | 135-263 | None |
| A0A0B4HJ12 | 230-386 | None |
| A0A366NVX8 | 21-161 | None |
| X0JN36 | 226-383 | None |
| A0A2T4A1M4 | 1-155 | None |
| A0A135TK12 | 104-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.