DPCstruct | MC30919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0WNX1 | 1-102 | MVQITTHDAVLATAAALLDVTSAVASMPSGNWPSSLGSVKYGPPYVVKAGTVFDGQMKTYERSNVDCKGQNECGKDAAVFLVEPGAT… |
| D0NV97 | 179-255 | IVRYKKPYTIKAGEVFDGKMQIFERSDITCSGGEGQKDTAVFLVEAGGTLKNAIIGKNQKEGVHCDYHDCTIENVWW |
| A0A5C3M580 | 1-119 | None |
| V9DWG4 | 1-110 | None |
| A0A833RN90 | 474-601 | None |
| A0A833S5E7 | 469-568 | None |
| A0A1Y0G3D3 | 21-145 | None |
| A0A6G0XE98 | 3-128 | None |
| A0A0N0LAT1 | 4-108 | None |
| A0A2P4XL32 | 534-670 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.