DPCstruct | MC30917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0WNR2 | 562-677 | VIALGVRTVQLAINTSDLSNRFLRQPVLGGEFAAVWDLYGWIYMYEWAETSREVLSFEGDANVLLLISNKYDSIVNQAQGLEVKKSA… |
| A0A6G0WNQ3 | 256-376 | GVSMIRFAVSLDDSSSILLRRQILGSTVQEWDFFGWLYAYEWVQGYREVVSFEGDAGVISIISDKYDPFITQAQELEVPRSACVILW… |
| A0A067BJW4 | 6-112 | None |
| A0A1V9ZWE1 | 9-99 | None |
| A0A1W0A097 | 27-132 | None |
| A0A1W0A2F2 | 40-177 | None |
| A0A1W0A3M2 | 47-183 | None |
| A0A6G0X4Q7 | 294-412 | None |
| A0A1V9ZDJ2 | 29-152 | None |
| A0A067BFS7 | 14-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.