DPCstruct | MC30914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 335 ± 40 aa |
| Standard deviation of domain lengths | 40.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5QXK5 | 345-663 | NPSSVVNASYVDSLLDATFARIVADKNVFNEEFGRLGQLRLFLNASYGFKDVRSSDNDVKAQLIHRHFAQLDGPQDFTIDSCGNVGG… |
| A0A6G0W9I7 | 58-385 | NAIHSRVLDKKLKFDALYEQMVAVSYTNVRKYDQQPPKKKARLEVGTSGLHGHFADLIDESPTDIYLSRDGFHKESPDDTSPSWIEN… |
| A0A833S607 | 2-284 | None |
| A0A833SAL8 | 469-767 | None |
| G4ZNW1 | 124-442 | None |
| A0A0W8CB61 | 2-278 | None |
| A0A6G0S3X1 | 52-434 | None |
| A0A6G0R3P9 | 187-595 | None |
| A0A1Y2BMN6 | 454-841 | None |
| A0A329RLB8 | 1-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.