DPCstruct | MC3091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317BGY8 | 271-358 | PNSPEFDKYHIITNHDMNGLNAGVFLFRVNKWSSMFFSAVLAYPLYYPDVDLGFAEQTAMQLVLSSAEWKDHQAIVPQHWFNLYPDGD |
| A0A366PJM5 | 1-101 | MQHINGSDTQQDIADNIYLLATKDWNGLNNGVFLVRINRWSIDLFSAILALRHYWPDADLPFTEQSAMELLLHEAPFNENVIWVPHW… |
| A0A2D3VG35 | 67-157 | None |
| A0A3M9XWA6 | 62-147 | None |
| C4K028 | 9-91 | None |
| A0A6V7NKU8 | 11-97 | None |
| A0A0G2EY12 | 167-251 | None |
| A0A074Y390 | 426-508 | None |
| A0A1V6XGG5 | 20-112 | None |
| A0A812KWP5 | 144-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.