DPCstruct | MC3090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9LPQ5 | 508-664 | MVLYEDLRVYTFWRAEDAHYRAQQTAYRKTGTEWELLGDLALRLWHENEAKEAFEMCLDHKFSAKAWMKLLQIYAKEGNTQKALLAA… |
| A0A366PG18 | 1-155 | MVLYEDLRVYTIWRTQMAQYRAQSMQYRKSAEEWEILGSLAERLQHMDEAMEAYRSCLAARFSPKALAGILRVFERNKNTREAVAAF… |
| A0A1Y1W3E6 | 779-961 | None |
| D6RQ86 | 511-665 | None |
| A0A6C1E0S4 | 1-166 | None |
| A0A4Z0A3F4 | 127-284 | None |
| A0A3M7HII1 | 542-662 | None |
| C4JYL1 | 448-602 | None |
| A0A218YUT6 | 542-672 | None |
| A0A1B7SB26 | 482-631 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.